| Product Number |
ARP36966_P050 |
| Product Page |
www.avivasysbio.com/rel-antibody-middle-region-arp36966-p050.html |
| Name |
Rel Antibody - middle region (ARP36966_P050) |
| Protein Size (# AA) |
588 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
19696 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Reticuloendotheliosis oncogene |
| Alias Symbols |
c-R, c-Rel |
| Peptide Sequence |
Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Nanog; POLD3; Ssbp4; Tlx3; Bcl2a1a; Il12b; Rel; Rag2; Rag1; Igk-V28; Nos2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Rel (ARP36966_P050) antibody |
| Blocking Peptide |
For anti-Rel (ARP36966_P050) antibody is Catalog # AAP36966 (Previous Catalog # AAPS06612) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
A4QPD3 |
| Protein Name |
Proto-oncogene c-Rel Ensembl ENSMUSP00000099928 |
| Protein Accession # |
NP_033070 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009044 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Rel |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 86%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Mouse Lung
 | WB Suggested Anti-Rel Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Lung |
|
| Image 2 | Mouse
 | WB Suggested Anti-REL Antibody
Positive Control: Lane1: 100ug mouse liver, Lane2: 100ug mouse brain, Lane3: 100ug mouse heart, Lane4: 100ug mouse kidney, Lane5: 100ug mouse lung, Lane6: 100ug mouse thymus, Lane7: 100ug mouse spleen, Lane8: 100ug mouse testis, Lane9: 100ug mouse HeLa
Primary Antibody Dilution : 1:1000
Secondary Antibody : Anti-rabbit-AP
Secondry Antibody Dilution : 1:10,000
Submitted by: Andreia Carvalho, Instituto de Biologia Molecular e Celular, Universidade do Porto (IBMC-UP) |
|
| Image 3 | Human Bone Marrow
 | Rabbit Anti-REL Antibody
Catalog Number: ARP36966_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue
Observed Staining: Nucleus, Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
