Product Number |
ARP36958_P050 |
Product Page |
www.avivasysbio.com/pgr-antibody-middle-region-arp36958-p050.html |
Name |
Pgr Antibody - middle region (ARP36958_P050) |
Protein Size (# AA) |
926 amino acids |
Molecular Weight |
99 |
NCBI Gene Id |
18667 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Progesterone receptor |
Alias Symbols |
P, PR, NR3, PR-A, PR-B, NR3C3, BB114106, 9930019P03Rik |
Peptide Sequence |
Synthetic peptide located within the following region: SGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Protein Interactions |
Hsp90ab1; Esr1; Stat3; Klf9; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Pgr (ARP36958_P050) antibody |
Blocking Peptide |
For anti-Pgr (ARP36958_P050) antibody is Catalog # AAP36958 (Previous Catalog # AAPP08973) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Pgr |
Uniprot ID |
A6H6A5 |
Protein Name |
Progesterone receptor EMBL AAI45808.1 Ensembl ENSMUSP00000063562 |
Protein Accession # |
NP_032855 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_008829 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Pgr |
Predicted Species Reactivity |
Mouse, Rat, Dog, Guinea Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 91%; Guinea Pig: 91%; Mouse: 100%; Rat: 91% |
Image 1 | Mouse Thymus
| WB Suggested Anti-Pgr Antibody Titration: 0.2-1 ug/ml Positive Control: Mouse Thymus |
|
|