Pgr Antibody - middle region (ARP36958_P050)

Data Sheet
 
Product Number ARP36958_P050
Product Page www.avivasysbio.com/pgr-antibody-middle-region-arp36958-p050.html
Name Pgr Antibody - middle region (ARP36958_P050)
Protein Size (# AA) 926 amino acids
Molecular Weight 99
NCBI Gene Id 18667
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Progesterone receptor
Alias Symbols P, PR, NR3, PR-A, PR-B, NR3C3, BB114106, 9930019P03Rik
Peptide Sequence Synthetic peptide located within the following region: SGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions Hsp90ab1; Esr1; Stat3; Klf9;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Pgr (ARP36958_P050) antibody
Blocking Peptide For anti-Pgr (ARP36958_P050) antibody is Catalog # AAP36958 (Previous Catalog # AAPP08973)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse Pgr
Uniprot ID A6H6A5
Protein Name Progesterone receptor EMBL AAI45808.1 Ensembl ENSMUSP00000063562
Protein Accession # NP_032855
Purification Affinity Purified
Nucleotide Accession # NM_008829
Tested Species Reactivity Mouse
Gene Symbol Pgr
Predicted Species Reactivity Mouse, Rat, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 91%; Guinea Pig: 91%; Mouse: 100%; Rat: 91%
Image 1
Mouse Thymus
WB Suggested Anti-Pgr Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com