| Product Number |
ARP36943_T100 |
| Product Page |
www.avivasysbio.com/nkx2-3-antibody-middle-region-arp36943-t100.html |
| Name |
NKX2-3 Antibody - middle region (ARP36943_T100) |
| Protein Size (# AA) |
362 amino acids |
| Molecular Weight |
40kDa |
| NCBI Gene Id |
18089 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
NK2 transcription factor related, locus 3 (Drosophila) |
| Alias Symbols |
ti, Nkx2., Nkx-2., Nkx2.3, nkx2-C, tinman, Nkx-2.3 |
| Peptide Sequence |
Synthetic peptide located within the following region: GTHAPPPPPRRVAVPVLVRDGKPCVTPSAQTYGSPYGVGAGAYSYNSFPA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tarlinton,D., et al., (2003) J. Immunol. 170 (8), 4002-4010 |
| Description of Target |
NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. |
| Protein Interactions |
Zfp263; Cdx1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NKX2-3 (ARP36943_T100) antibody |
| Blocking Peptide |
For anti-NKX2-3 (ARP36943_T100) antibody is Catalog # AAP36943 (Previous Catalog # AAPP09145) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse NKX2-3 |
| Uniprot ID |
P97334 |
| Protein Name |
Homeobox protein Nkx-2.3 |
| Protein Accession # |
NP_032725 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_008699 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
NKX2-3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 85%; Guinea Pig: 85%; Human: 77%; Mouse: 100%; Rat: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-NKX2-3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate |
|
|
