| Product Number |
ARP36933_P050 |
| Product Page |
www.avivasysbio.com/nab2-antibody-middle-region-arp36933-p050.html |
| Name |
Nab2 Antibody - middle region (ARP36933_P050) |
| Protein Size (# AA) |
525 amino acids |
| Molecular Weight |
57 |
| NCBI Gene Id |
17937 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ngfi-A binding protein 2 |
| Alias Symbols |
AI451907 |
| Peptide Sequence |
Synthetic peptide located within the following region: APPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
PRKAA1; Chd4; Egr1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Nab2 (ARP36933_P050) antibody |
| Blocking Peptide |
For anti-Nab2 (ARP36933_P050) antibody is Catalog # AAP36933 (Previous Catalog # AAPP08774) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Nab2 |
| Uniprot ID |
Q61127 |
| Protein Name |
NGFI-A-binding protein 2 |
| Protein Accession # |
NP_032694 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_008668 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Nab2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Nab2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Kidney |
|
|
