| Product Number |
ARP36929_P050 |
| Product Page |
www.avivasysbio.com/pias2-antibody-c-terminal-region-arp36929-p050.html |
| Name |
Pias2 Antibody - C-terminal region (ARP36929_P050) |
| Protein Size (# AA) |
490 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
17344 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protein inhibitor of activated STAT 2 |
| Alias Symbols |
Di, PI, DIP, Dib, Miz, Miz1, PIAS, SIZ2, ARIP3, PIASxb, AI462206, AU018068, PIASxbeta, PIASxalpha, PIASxalpha6 |
| Peptide Sequence |
Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. It seems to be mostly involved in gene silencing. It binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. |
| Protein Interactions |
Pparg; Egr2; Plagl2; Trim32; Trp53; DHX9; Nfkb1; Gtf2i; GTF2IRD1; HDAC3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Pias2 (ARP36929_P050) antibody |
| Blocking Peptide |
For anti-Pias2 (ARP36929_P050) antibody is Catalog # AAP36929 (Previous Catalog # AAPP23711) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Pias2 |
| Uniprot ID |
Q8C5D8 |
| Protein Name |
E3 SUMO-protein ligase PIAS2 |
| Protein Accession # |
AAB96678 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001164167 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Pias2 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 93% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-Pias2 Antibody Titration: 0.2-1 ug/ml
Positive Control: NIH/3T3 cell lysate |
|
| Image 2 | Mouse Pancreas
 | Mouse Pancreas |
|
| Image 3 | Human heart
 | WB Suggested Anti-Pias2 antibody Titration: 1 ug/mL
Sample Type: Human heart |
|
