| Product Number |
ARP36913_T100 |
| Product Page |
www.avivasysbio.com/ascl2-antibody-middle-region-arp36913-t100.html |
| Name |
ASCL2 Antibody - middle region (ARP36913_T100) |
| Protein Size (# AA) |
263 amino acids |
| Molecular Weight |
28 kDa |
| NCBI Gene Id |
17173 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Achaete-scute complex homolog 2 (Drosophila) |
| Alias Symbols |
Mas, Mash2, bHLHa, bHLHa45, 2410083I15Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: AAVARRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Georgiades,P. (2006) Development 133 (6), 1059-1068 |
| Description of Target |
Mouse ASCL2 is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It is the first transcription factor shown to play a critical part in the development of the mammalian trophoblast lineage. |
| Protein Interactions |
H3f3a; Hist1h3a; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-ASCL2 (ARP36913_T100) antibody |
| Blocking Peptide |
For anti-ASCL2 (ARP36913_T100) antibody is Catalog # AAP36913 (Previous Catalog # AAPP09121) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
O35885 |
| Protein Name |
Achaete-scute homolog 2 |
| Protein Accession # |
NP_032580 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_008554 |
| Tested Species Reactivity |
Human, Mouse, Rat |
| Gene Symbol |
ASCL2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 93%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 79% |
| Image 1 |
 | 25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|
|
