Irf1 Antibody - middle region (ARP36903_P050)

• Product Number: ARP36903_P050
• Name: Irf1 Antibody - middle region (ARP36903_P050)
• Protein Size (# AA): 329 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 16362
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Interferon regulatory factor 1
• Alias Symbols: Irf, Irf-1, AU020929
• Peptide Sequence: Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Irf1 specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and activates those genes.Irf1 acts as a tumor suppressor.
• Protein Interactions: Ubc; Sumo1; Ube2i; Pias3; Tbk1; Polr2a;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Irf1 (ARP36903_P050) antibody is Catalog # AAP36903 (Previous Catalog # AAPP09879)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: P15314
• Protein Name: Interferon regulatory factor 1
• Protein Accession #: NP_032416
• Purification: Affinity Purified
• Nucleotide Accession #: NM_008390
• Tested Species Reactivity: Mouse
• Gene Symbol: Irf1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 83%; Guinea Pig: 92%; Horse: 83%; Human: 83%; Mouse: 100%; Rabbit: 85%; Rat: 92%; Sheep: 85%; Yeast: 83%
• Image 1: Mouse Brain
  
  Host: Mouse
  Target Name: IRF1
  Sample Tissue: Mouse Brain
  Antibody Dilution: 1ug/ml
• Image 2: Mouse Uterus
  
  WB Suggested Anti-Irf1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Mouse Uterus