website statistics
Product Datasheet: ARP36895_T100 - HSF1 antibody - C-terminal region (ARP36895_T100) - Aviva Systems Biology
HSF1 antibody - C-terminal region (ARP36895_T100)
Data Sheet
Product Number ARP36895_T100
Product Page
Product Name HSF1 antibody - C-terminal region (ARP36895_T100)
Size 100 ul
Gene Symbol HSF1
Alias Symbols AA960185
Protein Size (# AA) 503 amino acids
Molecular Weight 55kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 15499
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Heat shock factor 1
Description This is a rabbit polyclonal antibody against HSF1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: YTAQPLFLLDPDAVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLTG
Target Reference Shamovsky,I., et al., (2006) Nature 440 (7083), 556-560
Description of Target HSF1 mediates the stress induced expression of heat shock proteins.
Protein Interactions Hsp90ab1; Rela; Atf3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-HSF1 (ARP36895_T100) antibody is Catalog # AAP36895 (Previous Catalog # AAPP09105)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse HSF1
Complete computational species homology data Anti-HSF1 (ARP36895_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HSF1.
Swissprot Id P38532-2
Protein Name Heat shock factor protein 1
Protein Accession # NP_032322
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HSF1.
Nucleotide Accession # NM_008296
Replacement Item This antibody may replace item sc-13516 from Santa Cruz Biotechnology.
Conjugation Options

ARP36895_T100-FITC Conjugated

ARP36895_T100-HRP Conjugated

ARP36895_T100-Biotin Conjugated

CB Replacement sc-13516; sc-17756; sc-17757; sc-393509; sc-393677; sc-8061; sc-9144
Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Goat: 92%; Guinea Pig: 93%; Horse: 92%; Human: 91%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Image 1
Human Fetal Brain

Host: Rabbit
Target Name: HSF1
Sample Tissue: Human Fetal Brain
Antibody Dilution: 1.0ug/ml


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |