HSF1 Antibody - C-terminal region (ARP36895_T100)

• Product Number: ARP36895_T100
• Name: HSF1 Antibody - C-terminal region (ARP36895_T100)
• Protein Size (# AA): 503 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 15499
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Heat shock factor 1
• Alias Symbols: HSTF, HSTF 1, AA960185, Hsf1beta, Hsf1alpha
• Peptide Sequence: Synthetic peptide located within the following region: YTAQPLFLLDPDAVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLTG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shamovsky,I., et al., (2006) Nature 440 (7083), 556-560
• Description of Target: HSF1 mediates the stress induced expression of heat shock proteins.
• Protein Interactions: Hsp90ab1; Rela; Atf3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HSF1 (ARP36895_T100) antibody is Catalog # AAP36895 (Previous Catalog # AAPP09105)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse HSF1
• Uniprot ID: P38532-2
• Protein Name: Heat shock factor protein 1
• Protein Accession #: NP_032322
• Purification: Protein A purified
• Nucleotide Accession #: NM_008296
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: HSF1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Goat: 92%; Guinea Pig: 93%; Horse: 92%; Human: 91%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Image 1: Human Fetal Brain
  
  Host: Rabbit
  Target Name: HSF1
  Sample Tissue: Human Fetal Brain
  Antibody Dilution: 1.0ug/ml