Product Number |
ARP36894_P050 |
Product Page |
www.avivasysbio.com/hsf1-antibody-c-terminal-region-arp36894-p050.html |
Name |
HSF1 Antibody - C-terminal region (ARP36894_P050) |
Protein Size (# AA) |
503 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
15499 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Heat shock factor 1 |
Alias Symbols |
HSTF, HSTF 1, AA960185, Hsf1beta, Hsf1alpha |
Peptide Sequence |
Synthetic peptide located within the following region: AVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Shamovsky,I., et al., (2006) Nature 440 (7083), 556-560 |
Description of Target |
HSF1 mediates the stress induced expression of heat shock proteins. |
Protein Interactions |
Hsp90ab1; Rela; Atf3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HSF1 (ARP36894_P050) antibody |
Blocking Peptide |
For anti-HSF1 (ARP36894_P050) antibody is Catalog # AAP36894 (Previous Catalog # AAPP09104) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse HSF1 |
Uniprot ID |
P38532-2 |
Protein Name |
Heat shock factor protein 1 |
Protein Accession # |
NP_032322 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_008296 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
HSF1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 79%; Horse: 86%; Human: 86%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-HSF1 Antibody Titration: 0.06125ug/ml ELISA Titer: 1:62500 Positive Control: SP2/0 cell lysate |
|
|