HSF1 Antibody - C-terminal region (ARP36894_P050)

Data Sheet
 
Product Number ARP36894_P050
Product Page www.avivasysbio.com/hsf1-antibody-c-terminal-region-arp36894-p050.html
Name HSF1 Antibody - C-terminal region (ARP36894_P050)
Protein Size (# AA) 503 amino acids
Molecular Weight 55kDa
NCBI Gene Id 15499
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Heat shock factor 1
Alias Symbols HSTF, HSTF 1, AA960185, Hsf1beta, Hsf1alpha
Peptide Sequence Synthetic peptide located within the following region: AVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Shamovsky,I., et al., (2006) Nature 440 (7083), 556-560
Description of Target HSF1 mediates the stress induced expression of heat shock proteins.
Protein Interactions Hsp90ab1; Rela; Atf3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HSF1 (ARP36894_P050) antibody
Blocking Peptide For anti-HSF1 (ARP36894_P050) antibody is Catalog # AAP36894 (Previous Catalog # AAPP09104)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse HSF1
Uniprot ID P38532-2
Protein Name Heat shock factor protein 1
Protein Accession # NP_032322
Purification Affinity Purified
Nucleotide Accession # NM_008296
Tested Species Reactivity Mouse
Gene Symbol HSF1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 79%; Horse: 86%; Human: 86%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100%
Image 1
Mouse SP2/0
WB Suggested Anti-HSF1 Antibody Titration: 0.06125ug/ml
ELISA Titer: 1:62500
Positive Control: SP2/0 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com