| Product Number |
ARP36890_T100 |
| Product Page |
www.avivasysbio.com/hoxb13-antibody-middle-region-arp36890-t100.html |
| Name |
HOXB13 Antibody - middle region (ARP36890_T100) |
| Protein Size (# AA) |
286 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
15408 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Homeobox B13 |
| Peptide Sequence |
Synthetic peptide located within the following region: GYFGGGYYSCRVSRSSLKPCAQTAALATYPSETPAPGEEYPSRPTEFAFY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Albrecht,A.N., et al., (2004) Hum. Mol. Genet. 13 (20), 2351-2359 |
| Description of Target |
HOXB13 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB |
| Protein Interactions |
Otx2; Dlx5; Dlx1; Alx4; Meis1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXB13 (ARP36890_T100) antibody |
| Blocking Peptide |
For anti-HOXB13 (ARP36890_T100) antibody is Catalog # AAP36890 (Previous Catalog # AAPP09039) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse HOXB13 |
| Uniprot ID |
P70321 |
| Protein Name |
Homeobox protein Hox-B13 |
| Protein Accession # |
NP_032293 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_008267 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HOXB13 |
| Predicted Species Reactivity |
Mouse, Rat, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 79%; Horse: 79%; Mouse: 100%; Rabbit: 79%; Rat: 100% |
| Image 1 | Human Prostate
 | WB Suggested Anti-HOXB13 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human Prostate |
|
|
