| Product Number |
ARP36887_T100 |
| Product Page |
www.avivasysbio.com/hoxb1-antibody-n-terminal-region-arp36887-t100.html |
| Name |
Hoxb1 Antibody - N-terminal region (ARP36887_T100) |
| Protein Size (# AA) |
297 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
15407 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Homeobox B1 |
| Alias Symbols |
Hox-2., Hox-2.9 |
| Peptide Sequence |
Synthetic peptide located within the following region: QQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYYSVGQSEGDGSYFHPSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Isono,K., (2006) Mol. Cell. Biol. 26 (7), 2758-2771 |
| Description of Target |
HOXB1 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB |
| Protein Interactions |
Sirt1; Cers2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Hoxb1 (ARP36887_T100) antibody |
| Blocking Peptide |
For anti-Hoxb1 (ARP36887_T100) antibody is Catalog # AAP36887 (Previous Catalog # AAPP23362) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Hoxb1 |
| Uniprot ID |
P17919 |
| Protein Name |
Homeobox protein Hox-B1 |
| Protein Accession # |
NP_032292 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_008266 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Hoxb1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Horse: 83%; Human: 86%; Mouse: 100%; Pig: 86%; Rat: 93% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-Hoxb1 Antibody Titration: 2.5ug/ml
Positive Control: SP2/0 cell lysate |
|
|
