Product Number |
ARP36877_T100 |
Product Page |
www.avivasysbio.com/foxd1-antibody-n-terminal-region-arp36877-t100.html |
Name |
FOXD1 Antibody - N-terminal region (ARP36877_T100) |
Protein Size (# AA) |
465 amino acids |
Molecular Weight |
46 kDa |
NCBI Gene Id |
15229 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Forkhead box D1 |
Alias Symbols |
BF-2, FREA, Hfh10, FREAC4, Hfhbf2, AI385632 |
Peptide Sequence |
Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Airik,R., et al., (2006) J. Clin. Invest. 116 (3), 663-674 |
Description of Target |
FOXD1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXD1, specifically activate the 1b promoter of the RI alpha gene in testicular Sertoli cells. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-FOXD1 (ARP36877_T100) antibody |
Blocking Peptide |
For anti-FOXD1 (ARP36877_T100) antibody is Catalog # AAP36877 (Previous Catalog # AAPY00628) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse FOXD1 |
Uniprot ID |
Q61345 |
Protein Name |
Forkhead box protein D1 |
Protein Accession # |
NP_032268 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_008242 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
FOXD1 |
Predicted Species Reactivity |
Mouse, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 81% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-FOXD1 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: SP2/0 cell lysate |
| Image 2 |
| 25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.
|
|
|