FOXD1 Antibody - N-terminal region (ARP36877_T100)

Data Sheet
 
Product Number ARP36877_T100
Product Page www.avivasysbio.com/foxd1-antibody-n-terminal-region-arp36877-t100.html
Name FOXD1 Antibody - N-terminal region (ARP36877_T100)
Protein Size (# AA) 465 amino acids
Molecular Weight 46 kDa
NCBI Gene Id 15229
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Forkhead box D1
Alias Symbols BF-2, FREA, Hfh10, FREAC4, Hfhbf2, AI385632
Peptide Sequence Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Airik,R., et al., (2006) J. Clin. Invest. 116 (3), 663-674
Description of Target FOXD1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXD1, specifically activate the 1b promoter of the RI alpha gene in testicular Sertoli cells.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-FOXD1 (ARP36877_T100) antibody
Blocking Peptide For anti-FOXD1 (ARP36877_T100) antibody is Catalog # AAP36877 (Previous Catalog # AAPY00628)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse FOXD1
Uniprot ID Q61345
Protein Name Forkhead box protein D1
Protein Accession # NP_032268
Purification Protein A purified
Nucleotide Accession # NM_008242
Tested Species Reactivity Mouse
Gene Symbol FOXD1
Predicted Species Reactivity Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 81%
Image 1
Mouse SP2/0
WB Suggested Anti-FOXD1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
Image 2

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com