| Product Number |
ARP36874_P050 |
| Product Page |
www.avivasysbio.com/foxj1-antibody-middle-region-arp36874-p050.html |
| Name |
Foxj1 Antibody - middle region (ARP36874_P050) |
| Protein Size (# AA) |
421 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
15223 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Forkhead box J1 |
| Alias Symbols |
Hfh4, HFH-4, FKHL-1, FKHL-13 |
| Peptide Sequence |
Synthetic peptide located within the following region: HPAFARQASQEPSAAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Rfx2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Foxj1 (ARP36874_P050) antibody |
| Blocking Peptide |
For anti-Foxj1 (ARP36874_P050) antibody is Catalog # AAP36874 (Previous Catalog # AAPY00625) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Foxj1 |
| Uniprot ID |
Q3US42 |
| Protein Name |
Forkhead box protein J1 |
| Protein Accession # |
NP_032266 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_008240 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Foxj1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 86%; Mouse: 100%; Rabbit: 83%; Rat: 100% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Foxj1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Heart |
|
|
