| Product Number |
ARP36873_P050 |
| Product Page |
www.avivasysbio.com/foxq1-antibody-middle-region-arp36873-p050.html |
| Name |
Foxq1 Antibody - middle region (ARP36873_P050) |
| Protein Size (# AA) |
400 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
15220 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Forkhead box Q1 |
| Alias Symbols |
sa, Hfh1, HFH-1, Hfh1l |
| Peptide Sequence |
Synthetic peptide located within the following region: ADGVFRRRRKRLSHRTTVSASGLRPEEAPPGPAGTPQPAPAARSSPIARS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Ssbp3; Ssbp2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Foxq1 (ARP36873_P050) antibody |
| Blocking Peptide |
For anti-Foxq1 (ARP36873_P050) antibody is Catalog # AAP36873 (Previous Catalog # AAPY00624) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Foxq1 |
| Uniprot ID |
Q9JJ18 |
| Protein Name |
Forkhead box protein Q1 |
| Protein Accession # |
NP_032265 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_008239 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Foxq1 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 100% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-Foxq1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Brain |
|
|
