| Product Number |
ARP36860_T100 |
| Product Page |
www.avivasysbio.com/gata5-antibody-c-terminal-region-arp36860-t100.html |
| Name |
GATA5 Antibody - C-terminal region (ARP36860_T100) |
| Protein Size (# AA) |
404 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
14464 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
GATA binding protein 5 |
| Peptide Sequence |
Synthetic peptide located within the following region: SPTLLNSESSATTLKAESSLASPVCAGPTITSQASSPADESLASSHLEFK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mermod,N., et al., (2005) Mol. Cell. Biol. 25 (24), 10953-10964 |
| Description of Target |
GATA5 is induced at an early stage of endothelial-endocardial differentiation prior to expression of such early endocardial markers as Tie2 and ErbB3. It is required for differentiation of cardiogenic precursors into endothelial endocardial cells. |
| Protein Interactions |
Smad4; Rorb; Med16; Zfp292; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GATA5 (ARP36860_T100) antibody |
| Blocking Peptide |
For anti-GATA5 (ARP36860_T100) antibody is Catalog # AAP36860 (Previous Catalog # AAPY00611) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse GATA5 |
| Uniprot ID |
P97489 |
| Protein Name |
Transcription factor GATA-5 |
| Protein Accession # |
NP_032119 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_008093 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
GATA5 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-GATA5 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: SP2/0 cell lysate |
| | Image 2 | Mouse Testis
 | Host: Rabbit
Target Name: GATA5
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml |
| | Image 3 | Mouse Testis
 | Host: Mouse
Target Name: GATA5
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml |
|
|
