| Product Number |
ARP36839_T100 |
| Product Page |
www.avivasysbio.com/dlx4-antibody-n-terminal-region-arp36839-t100.html |
| Name |
DLX4 Antibody - N-terminal region (ARP36839_T100) |
| Protein Size (# AA) |
240 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
13394 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Distal-less homeobox 4 |
| Alias Symbols |
Dlx, Dlx-, Dlx7, Dlx-4 |
| Peptide Sequence |
Synthetic peptide located within the following region: YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kelly,R.G., et al., (2004) Hum. Mol. Genet. 13 (22), 2829-2840 |
| Description of Target |
DLX4 is a member of the family of Dlx genes that are involved in early vertebrate morphogenesis, notably of the head. |
| Protein Interactions |
Sp7; Zfp263; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DLX4 (ARP36839_T100) antibody |
| Blocking Peptide |
For anti-DLX4 (ARP36839_T100) antibody is Catalog # AAP36839 (Previous Catalog # AAPP09912) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse DLX4 |
| Uniprot ID |
P70436 |
| Protein Name |
Homeobox protein DLX-4 |
| Protein Accession # |
NP_031893 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_007867 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
DLX4 |
| Predicted Species Reactivity |
Human, Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 100%; Rat: 86% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-DLX4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate |
|
|
