Product Number |
ARP36830_P050 |
Product Page |
www.avivasysbio.com/ciita-antibody-c-terminal-region-arp36830-p050.html |
Name |
CIITA Antibody - C-terminal region (ARP36830_P050) |
Protein Size (# AA) |
1078 amino acids |
Molecular Weight |
119kDa |
NCBI Gene Id |
12265 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
class II transactivator |
Alias Symbols |
C2t, C2ta, Gm9475, Mhc2ta, EG669998 |
Peptide Sequence |
Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Pennini,M.E., et al., (2006) J. Immunol. 176 (7), 4323-4330 |
Description of Target |
This gene encodes a member of the NOD-like receptor protein family. This protein acts as a transcriptional coactivator and component of the enhanceosome complex to stimulate transcription of MHC class II genes in the adaptive immune response. This protein may also regulate the transcription of MHC class I genes. Mutations in the human gene have been linked to a rare immunodeficiency, bare lymphocyte syndrome, and homozygous knockout mice exhibit many features of this disease. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Protein Interactions |
Rfxank; Ssbp4; Ssbp3; Gmeb1; Cited4; Tcf3; Nfe2; Hoxa2; Ewsr1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CIITA (ARP36830_P050) antibody |
Blocking Peptide |
For anti-CIITA (ARP36830_P050) antibody is Catalog # AAP36830 (Previous Catalog # AAPP09903) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse C2TA |
Uniprot ID |
Q3U2P0 |
Protein Name |
MHC class II transactivator |
Protein Accession # |
NP_031601 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_007575 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
CIITA |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Human: 79%; Mouse: 100%; Rat: 93% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-C2TA Antibody Titration: 0.125ug/ml ELISA Titer: 1:62500 Positive Control: NIH/3T3 cell lysate |
|
|