| Product Number |
ARP36826_P050 |
| Product Page |
www.avivasysbio.com/bapx1-antibody-n-terminal-region-arp36826-p050.html |
| Name |
Bapx1 Antibody - N-terminal region (ARP36826_P050) |
| Protein Size (# AA) |
333 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
12020 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
NK3 homeobox 2 |
| Alias Symbols |
Bap, Bapx1, NKX3.2, Nkx-3., Nkx-3.2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Provot,S., (2006) Development 133 (4), 651-662 |
| Description of Target |
Bapx1 acts as a negative regulator of chondrocyte maturation. The constitutive RelA activation mediated by Bapx1 controls chondrocyte viability. |
| Protein Interactions |
Ikbkg; Ikbkb; Btrc; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Nkx3-2 (ARP36826_P050) antibody |
| Blocking Peptide |
For anti-Nkx3-2 (ARP36826_P050) antibody is Catalog # AAP36826 (Previous Catalog # AAPP09071) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Bapx1 |
| Uniprot ID |
P97503 |
| Protein Name |
Homeobox protein Nkx-3.2 |
| Protein Accession # |
NP_031550 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007524 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
Nkx3-2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 83%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 83%; Zebrafish: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-Bapx1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
| | Image 2 | Jurkat
 | Host: Rabbit
Target Name: Bapx1
Sample Type: Jurkat
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 0.5ug/mL
Peptide Concentration: 1.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12% |
|
|
