Product Number |
ARP36822_T100 |
Product Page |
www.avivasysbio.com/arntl-antibody-n-terminal-region-arp36822-t100.html |
Name |
ARNTL Antibody - N-terminal region (ARP36822_T100) |
Protein Size (# AA) |
229 amino acids |
Molecular Weight |
26kDa |
NCBI Gene Id |
11865 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Aryl hydrocarbon receptor nuclear translocator-like |
Alias Symbols |
Ar, MO, Bma, MOP3, Arnt3, Bmal1, bHLHe, BMAL1b, bHLHe5, bmal1b' |
Peptide Sequence |
Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sladek,M. (2004) Videnska 1083, Prague 4 142 20 |
Description of Target |
ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators. |
Protein Interactions |
Clock; Sirt1; Cry1; Usp2; Hif1a; Csnk1e; Ubc; Per2; Per1; Kmt2a; Dbp; Ezh2; Cry2; Rnf14; Epas1; Per3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ARNTL (ARP36822_T100) antibody |
Blocking Peptide |
For anti-ARNTL (ARP36822_T100) antibody is Catalog # AAP36822 (Previous Catalog # AAPP08696) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ARNTL |
Uniprot ID |
Q68HB9 |
Protein Name |
BMAL1 splice variant h EMBL AAU00990.1 |
Protein Accession # |
AAU00990 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001243048 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
ARNTL |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-ARNTL Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: NIH/3T3 cell lysate |
|