ARNTL Antibody - N-terminal region (ARP36822_T100)

Data Sheet
 
Product Number ARP36822_T100
Product Page www.avivasysbio.com/arntl-antibody-n-terminal-region-arp36822-t100.html
Name ARNTL Antibody - N-terminal region (ARP36822_T100)
Protein Size (# AA) 229 amino acids
Molecular Weight 26kDa
NCBI Gene Id 11865
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Aryl hydrocarbon receptor nuclear translocator-like
Alias Symbols Ar, MO, Bma, MOP3, Arnt3, Bmal1, bHLHe, BMAL1b, bHLHe5, bmal1b'
Peptide Sequence Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sladek,M. (2004) Videnska 1083, Prague 4 142 20
Description of Target ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators.
Protein Interactions Clock; Sirt1; Cry1; Usp2; Hif1a; Csnk1e; Ubc; Per2; Per1; Kmt2a; Dbp; Ezh2; Cry2; Rnf14; Epas1; Per3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ARNTL (ARP36822_T100) antibody
Blocking Peptide For anti-ARNTL (ARP36822_T100) antibody is Catalog # AAP36822 (Previous Catalog # AAPP08696)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse ARNTL
Uniprot ID Q68HB9
Protein Name BMAL1 splice variant h EMBL AAU00990.1
Protein Accession # AAU00990
Purification Protein A purified
Nucleotide Accession # NM_001243048
Tested Species Reactivity Mouse
Gene Symbol ARNTL
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Image 1
Mouse NIH-3T3
WB Suggested Anti-ARNTL Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com