MDC1 Antibody - C-terminal region (ARP36798_P050)

Data Sheet
 
Product Number ARP36798_P050
Product Page www.avivasysbio.com/mdc1-antibody-c-terminal-region-arp36798-p050.html
Name MDC1 Antibody - C-terminal region (ARP36798_P050)
Protein Size (# AA) 2089 amino acids
Molecular Weight 227kDa
NCBI Gene Id 9656
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mediator of DNA-damage checkpoint 1
Alias Symbols NFBD1
Peptide Sequence Synthetic peptide located within the following region: GKEEDVVTPKPGKRKRDQAEEEPNRIPSRSLRRTKLNQESTAPKVLFTGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene contains an N-terminal forkhead domain, two BRCA1 C-terminal (BRCT) motifs and a central domain with 13 repetitions of an approximately 41-amino acid sequence. The encoded protein is required to activate the intra-S phase and G2/M phase cell cycle checkpoints in response to DNA damage. This nuclear protein interacts with phosphorylated histone H2AX near sites of DNA double-strand breaks through its BRCT motifs, and facilitates recruitment of the ATM kinase and meiotic recombination 11 protein complex to DNA damage foci.
Protein Interactions RPA3; RPA2; RPA1; EED; TOPBP1; RNF8; UBC; LMNA; RAG1; CDC27; NCL; NBN; MRE11A; CSNK2A1; RAD50; CAPZB; CAPZA1; AUP1; ATP2A2; LOC729324; CHAMP1; HNRNPUL2; PGAM5; LSM12; ANAPC16; OSBPL8; DTX2; ZNF251; RBM17; FAM175A; LAS1L; LPCAT1; MYH14; SLC25A22; ZNF768; H
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MDC1 (ARP36798_P050) antibody
Blocking Peptide For anti-MDC1 (ARP36798_P050) antibody is Catalog # AAP36798 (Previous Catalog # AAPP08672)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MDC1
Uniprot ID Q14676
Protein Name Mediator of DNA damage checkpoint protein 1
Sample Type Confirmation

MDC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_055456
Purification Affinity Purified
Nucleotide Accession # NM_014641
Tested Species Reactivity Human
Gene Symbol MDC1
Predicted Species Reactivity Human, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 86%; Guinea Pig: 92%; Human: 100%
Image 1
Human HepG2
WB Suggested Anti-MDC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysateMDC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com