KCTD11 Antibody - N-terminal region (ARP36786_T100)

• Product Number: ARP36786_T100
• Name: KCTD11 Antibody - N-terminal region (ARP36786_T100)
• Protein Size (# AA): 232 amino acids
• Molecular Weight: 26kDa
• NCBI Gene Id: 147040
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Potassium channel tetramerisation domain containing 11
• Alias Symbols: REN, KCASH1, C17orf36, REN/KCTD11
• Peptide Sequence: Synthetic peptide located within the following region: ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Di,M., et al., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (29), 10833-10838
• Description of Target: The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation of the tumor-promoting Hedgehog pathway in medulloblastoma.
• Protein Interactions: KCTD11; CUL3; HDAC1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KCTD11 (ARP36786_T100) antibody is Catalog # AAP36786 (Previous Catalog # AAPP08386)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD11
• Uniprot ID: Q693B1
• Protein Name: BTB/POZ domain-containing protein KCTD11
• Protein Accession #: NP_001002914
• Purification: Protein A purified
• Nucleotide Accession #: NM_001002914
• Tested Species Reactivity: Human
• Gene Symbol: KCTD11
• Predicted Species Reactivity: Human, Mouse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 90%
• Image 1: Human HepG2
  
  WB Suggested Anti-KCTD11 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysate
• Image 2: Human 721_B
  
  Host: Rabbit
  Target Name: KCTD11
  Sample Type: 721_B
  Antibody Dilution: 1.0ug/ml