| Product Number |
ARP36776_P050 |
| Product Page |
www.avivasysbio.com/trpm3-antibody-n-terminal-region-arp36776-p050.html |
| Name |
TRPM3 Antibody - N-terminal region (ARP36776_P050) |
| Protein Size (# AA) |
230 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
80036 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transient receptor potential cation channel, subfamily M, member 3 |
| Alias Symbols |
GON-2, MLSN2, LTRPC3 |
| Peptide Sequence |
Synthetic peptide located within the following region: RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oberwinkler,J., et al., (2005) J. Biol. Chem. 280 (23), 22540-22548 |
| Description of Target |
TRPM3 belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRPM3 (ARP36776_P050) antibody |
| Blocking Peptide |
For anti-TRPM3 (ARP36776_P050) antibody is Catalog # AAP36776 (Previous Catalog # AAPP08376) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM3 |
| Uniprot ID |
Q5T8N8 |
| Protein Accession # |
NP_996831 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_206948 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRPM3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TRPM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
