TPTE Antibody - C-terminal region (ARP36750_T100)

• Product Number: ARP36750_T100
• Name: TPTE Antibody - C-terminal region (ARP36750_T100)
• Protein Size (# AA): 413 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 7179
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Transmembrane phosphatase with tensin homology
• Alias Symbols: CT44, PTEN2
• Peptide Sequence: Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Tapparel,C., et al., (2003) Gene 323, 189-199
• Description of Target: TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.
• Protein Interactions: LGR4; TUBB3; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TPTE (ARP36750_T100) antibody is Catalog # AAP36750 (Previous Catalog # AAPP08350)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TPTE
• Uniprot ID: Q6XPS4
• Protein Name: Putative tyrosine-protein phosphatase TPTE
• Protein Accession #: NP_954870
• Purification: Protein A purified
• Nucleotide Accession #: NM_199261
• Tested Species Reactivity: Human
• Gene Symbol: TPTE
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Pancreas
  
  Human Pancreas
• Image 2: Human HepG2
  
  WB Suggested Anti-TPTE Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:1562500
  Positive Control: HepG2 cell lysate