| Product Number |
ARP36747_T100 |
| Product Page |
www.avivasysbio.com/tpte-antibody-c-terminal-region-arp36747-t100.html |
| Name |
TPTE Antibody - C-terminal region (ARP36747_T100) |
| Protein Size (# AA) |
533 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
7179 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transmembrane phosphatase with tensin homology |
| Alias Symbols |
CT44, PTEN2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tapparel,C., Gene 323, 189-199 (2003) |
| Description of Target |
TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis. |
| Protein Interactions |
LGR4; TUBB3; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TPTE (ARP36747_T100) antibody |
| Blocking Peptide |
For anti-TPTE (ARP36747_T100) antibody is Catalog # AAP36747 (Previous Catalog # AAPS07610) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TPTE |
| Uniprot ID |
P56180-2 |
| Protein Name |
Putative tyrosine-protein phosphatase TPTE |
| Protein Accession # |
NP_954868 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_199259 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TPTE |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TPTE Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
