TRPC6 antibody - C-terminal region (ARP36717_T100)
Data Sheet
Product Number ARP36717_T100
Product Page
Product Name TRPC6 antibody - C-terminal region (ARP36717_T100)
Gene Symbol TRPC6
Protein Size (# AA) 931 amino acids
Molecular Weight 107kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Official Gene Full Name Transient receptor potential cation channel, subfamily C, member 6
Alias Symbols TRP6, FSGS2
NCBI Gene Id 7225
Host Rabbit
Clonality Polyclonal
Size 100 ul
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Description This is a rabbit polyclonal antibody against SNAPC2. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: GHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRS
Target Reference Acierno,J.S. (2001) Genomics 73 (2), 203-210
Description of Target The protein encoded by this gene forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).
Protein Interactions RNF24; TRPC3; ORAI1; TRPM2; TRPC6; SRC; ITPR3; MX1; FYN; TRPC7; TRPC5; TRPC4; TRPC1; TRPC2; ITPR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-TRPC6 (ARP36717_T100) antibody is Catalog # AAP36717 (Previous Catalog # AAPS08310)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TRPC6
Complete computational species homology data Anti-TRPC6 (ARP36717_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TRPC6.
Swissprot Id Q9Y210
Protein Name Short transient receptor potential channel 6
Protein Accession # NP_004612.2
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TRPC6.
Nucleotide Accession # NM_004621.5
Replacement Item This antibody may replace item sc-15056 from Santa Cruz Biotechnology.
Conjugation Options

ARP36717_T100-FITC Conjugated

ARP36717_T100-HRP Conjugated

ARP36717_T100-Biotin Conjugated

CB Replacement sc-15056; sc-15058; sc-19196; sc-19197; sc-20111; sc-514670
Species Reactivity Horse, Human, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Horse: 100%; Human: 100%; Pig: 100%
Image 1
Human kidney
Human kidney
Image 2
Human HepG2
WB Suggested Anti-TRPC6 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |