ZBP1 Antibody - middle region (ARP36711_T100)

Data Sheet
 
Product Number ARP36711_T100
Product Page www.avivasysbio.com/zbp1-antibody-middle-region-arp36711-t100.html
Name ZBP1 Antibody - middle region (ARP36711_T100)
Protein Size (# AA) 429 amino acids
Molecular Weight 47kDa
NCBI Gene Id 81030
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Z-DNA binding protein 1
Alias Symbols DAI, DLM1, DLM-1, C20orf183
Peptide Sequence Synthetic peptide located within the following region: LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.
Protein Interactions KLHL12; TRIP6; SIAH1; FMR1; CTBP2; CTBP1; PLXDC2; VPS35; PALD1; ORC3; KDM1A; ZNF516; TRAF3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZBP1 (ARP36711_T100) antibody
Blocking Peptide For anti-ZBP1 (ARP36711_T100) antibody is Catalog # AAP36711
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZBP1
Uniprot ID Q9H171
Protein Name Z-DNA-binding protein 1
Protein Accession # NP_110403
Purification Protein A purified
Nucleotide Accession # NM_030776
Tested Species Reactivity Human
Gene Symbol ZBP1
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZBP1 Antibody
Titration: 5.0 ug/ml
Positive Control: Jurkat Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com