| Product Number |
ARP36701_P050 |
| Product Page |
www.avivasysbio.com/alx4-antibody-c-terminal-region-arp36701-p050.html |
| Name |
ALX4 Antibody - C-terminal region (ARP36701_P050) |
| Protein Size (# AA) |
411 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
60529 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ALX homeobox 4 |
| Alias Symbols |
CRS5, FND2 |
| Peptide Sequence |
Synthetic peptide located within the following region: SVSGAGSHVGQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mavrogiannis,L.A., et al., (2001) Nat. Genet. 27 (1), 17-18 |
| Description of Target |
Alx4 is a member of the family of transcription factors that contain the paired-type homeodomain. In contrast to other types of homeodomains, the paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members. Alx4 is co-expressed with Cart1 at several sites during development, including the craniofacial mesenchyme, the mesenchymal derivatives of neural crest cells in the first branchial arch and the limb bud mesenchyme. |
| Protein Interactions |
ALX4; HOXB13; SOX2; HOXD3; HOXB6; HOXA3; FOXA3; GATA4; EMX1; CEBPE; SOX10; ALX1; LEF1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALX4 (ARP36701_P050) antibody |
| Blocking Peptide |
For anti-ALX4 (ARP36701_P050) antibody is Catalog # AAP36701 (Previous Catalog # AAPP08302) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ALX4 |
| Uniprot ID |
Q9H161 |
| Protein Name |
Homeobox protein aristaless-like 4 |
| Protein Accession # |
NP_068745 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021926 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALX4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 91%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ALX4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate |
|
|
