ALX4 Antibody - N-terminal region (ARP36700_T100)

• Product Number: ARP36700_T100
• Name: ALX4 Antibody - N-terminal region (ARP36700_T100)
• Protein Size (# AA): 411 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 60529
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: ALX homeobox 4
• Alias Symbols: CRS5, FND2
• Peptide Sequence: Synthetic peptide located within the following region: SSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Wakui,K., et al., (2005) Eur. J. Hum. Genet. 13 (5), 528-540
• Description of Target: ALX4 may be rendered functionally haploinsufficient by a position effect
• Protein Interactions: ALX4; HOXB13; SOX2; HOXD3; HOXB6; HOXA3; FOXA3; GATA4; EMX1; CEBPE; SOX10; ALX1; LEF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ALX4 (ARP36700_T100) antibody is Catalog # AAP36700 (Previous Catalog # AAPP08301)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALX4
• Uniprot ID: Q9H161
• Protein Name: Homeobox protein aristaless-like 4
• Protein Accession #: NP_068745
• Purification: Protein A purified
• Nucleotide Accession #: NM_021926
• Tested Species Reactivity: Human
• Gene Symbol: ALX4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 91%
• Image 1: Human HepG2
  
  WB Suggested Anti-ALX4 Antibody Titration: 0.625ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate