ANXA5 Antibody - N-terminal region (ARP36687_T100)

• Product Number: ARP36687_T100
• Name: ANXA5 Antibody - N-terminal region (ARP36687_T100)
• Protein Size (# AA): 320 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 308
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Annexin A5
• Alias Symbols: PP4, ANX5, ENX2, RPRGL3, HEL-S-7
• Peptide Sequence: Synthetic peptide located within the following region: AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kuijpers,T.W., et al., (2004) Blood 103 (10), 3915-3923
• Description of Target: ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.
• Protein Interactions: HUWE1; UBC; FUS; TUBGCP3; ASB9; BAG3; LAMC3; ATF2; VCP; NDRG1; PUM1; PPT2; HARS; APP; CDK2; TERF2IP; TINF2; ISG15; TERF2; TERF1; ANXA1; SUMO2; SUMO1; AI837181; Pds5a; PPP2R1B; H2AFX; SUPT4H1; EED; EIF4G1; KDR; FDFT1; IFNGR2; ITGB5; COL2A1; COL10A1; ACTG1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ANXA5 (ARP36687_T100) antibody is Catalog # AAP36687 (Previous Catalog # AAPP08114)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA5
• Uniprot ID: Q6FHB3
• Protein Name: Annexin A5
• Protein Accession #: NP_001145
• Purification: Protein A purified
• Nucleotide Accession #: NM_001154
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: ANXA5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Image 1: Human Placenta
  
  WB Suggested Anti-ANXA5 Antibody Titration: 0.625ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Placenta
• Image 2: Mouse Brain
  
  Host: Mouse
  Target Name: ANXA5
  Sample Tissue: Mouse Brain
  Antibody Dilution: 1ug/ml