CX36 Antibody - middle region (ARP36685_T100)

Data Sheet
 
Product Number ARP36685_T100
Product Page www.avivasysbio.com/cx36-antibody-middle-region-arp36685-t100.html
Name CX36 Antibody - middle region (ARP36685_T100)
Protein Size (# AA) 321 amino acids
Molecular Weight 35kDa
NCBI Gene Id 57369
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Gap junction protein, delta 2, 36kDa
Alias Symbols CX36, GJA9
Peptide Sequence Synthetic peptide located within the following region: NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Degen,J., et al., (2004) J. Comp. Neurol. 473 (4), 511-525
Description of Target GJA9, also called connexin-36 (CX36), is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons. See GJB2 (MIM 121011) for additional background information on connexins.[supplied by OMIM].
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GJD2 (ARP36685_T100) antibody
Blocking Peptide For anti-GJD2 (ARP36685_T100) antibody is Catalog # AAP36685 (Previous Catalog # AAPP08112)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CX36
Uniprot ID Q9UKL4
Protein Name Gap junction delta-2 protein
Protein Accession # NP_065711
Purification Protein A purified
Nucleotide Accession # NM_020660
Tested Species Reactivity Human
Gene Symbol GJD2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 88%; Guinea Pig: 88%; Horse: 88%; Human: 100%; Mouse: 88%; Rabbit: 86%; Rat: 88%
Image 1
Human Muscle
WB Suggested Anti-CX36 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human muscle
Image 2
Rat Brain, Rat Liver
Host: Rabbit
Target: GJD2
Positive control (+): Rat Brain (R-BR)
Negative control (-): Rat Liver (R-LI)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com