Product Number |
ARP36685_T100 |
Product Page |
www.avivasysbio.com/cx36-antibody-middle-region-arp36685-t100.html |
Name |
CX36 Antibody - middle region (ARP36685_T100) |
Protein Size (# AA) |
321 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
57369 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Gap junction protein, delta 2, 36kDa |
Alias Symbols |
CX36, GJA9 |
Peptide Sequence |
Synthetic peptide located within the following region: NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Degen,J., et al., (2004) J. Comp. Neurol. 473 (4), 511-525 |
Description of Target |
GJA9, also called connexin-36 (CX36), is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons. See GJB2 (MIM 121011) for additional background information on connexins.[supplied by OMIM]. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GJD2 (ARP36685_T100) antibody |
Blocking Peptide |
For anti-GJD2 (ARP36685_T100) antibody is Catalog # AAP36685 (Previous Catalog # AAPP08112) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CX36 |
Uniprot ID |
Q9UKL4 |
Protein Name |
Gap junction delta-2 protein |
Protein Accession # |
NP_065711 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_020660 |
Tested Species Reactivity |
Human |
Gene Symbol |
GJD2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 88%; Guinea Pig: 88%; Horse: 88%; Human: 100%; Mouse: 88%; Rabbit: 86%; Rat: 88% |
Image 1 | Human Muscle
| WB Suggested Anti-CX36 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Human muscle |
|
Image 2 | Rat Brain, Rat Liver
| Host: Rabbit Target: GJD2 Positive control (+): Rat Brain (R-BR) Negative control (-): Rat Liver (R-LI) Antibody concentration: 1ug/ml |
|