MCM7 Antibody - middle region (ARP36652_T100)

Data Sheet
 
Product Number ARP36652_T100
Product Page www.avivasysbio.com/mcm7-antibody-middle-region-arp36652-t100.html
Name MCM7 Antibody - middle region (ARP36652_T100)
Protein Size (# AA) 719 amino acids
Molecular Weight 81kDa
NCBI Gene Id 4176
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Minichromosome maintenance complex component 7
Alias Symbols MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3
Peptide Sequence Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ren,B., (2006) Oncogene 25 (7), 1090-1098
Description of Target MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Protein Interactions AK8; MIPOL1; C8orf34; USHBP1; MCMBP; CCDC102B; TRIM54; MBIP; UBQLN1; TRIM27; NAB2; KIFC3; GOLGA2; PNMA1; UBC; SP2; HAUS2; CEP250; CEP57; SUMO2; SUMO3; PCNA; STAU1; SUZ12; RNF2; MCM4; MCM2; HSP90AB1; PRMT1; PRRC1; CLUH; TOMM34; TRIM16; HYOU1; BAG3; MIB1; P
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MCM7 (ARP36652_T100) antibody
Blocking Peptide For anti-MCM7 (ARP36652_T100) antibody is Catalog # AAP36652 (Previous Catalog # AAPS06308)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MCM7
Uniprot ID P33993
Protein Name DNA replication licensing factor MCM7
Sample Type Confirmation

MCM7 is strongly supported by BioGPS gene expression data to be expressed in Daudi

Protein Accession # NP_005907
Purification Protein A purified
Nucleotide Accession # NM_005916
Tested Species Reactivity Human
Gene Symbol MCM7
Predicted Species Reactivity Human, Rat, Cow, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Rabbit: 92%; Rat: 92%
Image 1
Human Daudi
WB Suggested Anti-MCM7 Antibody Titration: 1.25ug/ml
Positive Control: Daudi cell lysateMCM7 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells
Image 2
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com