| Product Number |
ARP36648_P050 |
| Product Page |
www.avivasysbio.com/mcm4-antibody-n-terminal-region-arp36648-p050.html |
| Name |
Mcm4 Antibody - N-terminal region (ARP36648_P050) |
| Protein Size (# AA) |
862 amino acids |
| Molecular Weight |
97kDa |
| NCBI Gene Id |
29728 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Minichromosome maintenance complex component 4 |
| Alias Symbols |
Mcmd4 |
| Peptide Sequence |
Synthetic peptide located within the following region: PLEFDVSSPLTYGTPSSRVEGTPRSGVRGTPMRQRPDLGSARKGLQVDLQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Mcm4 is a replication licensing factor; homolog of yeast CDC21. |
| Protein Interactions |
Sumo3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Mcm4 (ARP36648_P050) antibody |
| Blocking Peptide |
For anti-Mcm4 (ARP36648_P050) antibody is Catalog # AAP36648 (Previous Catalog # AAPP07905) |
| Protein Accession # |
NP_387500 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_033651 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Mcm4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Rat Brain
 | WB Suggested Anti-Mcm4 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Brain |
|
|
