| Product Number |
ARP36638_T100 |
| Product Page |
www.avivasysbio.com/gje1-antibody-c-terminal-region-arp36638-t100.html |
| Name |
GJE1 Antibody - C-terminal region (ARP36638_T100) |
| Protein Size (# AA) |
279 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
349149 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Gap junction protein, gamma 3, 30.2kDa |
| Alias Symbols |
CX29, GJE1, CX30.2, CX31.3 |
| Peptide Sequence |
Synthetic peptide located within the following region: KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Scherer,S.W., et al., (2003) Science 300 (5620), 767-772 |
| Description of Target |
GJE1 is a protein component of GAP junction |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GJC3 (ARP36638_T100) antibody |
| Blocking Peptide |
For anti-GJC3 (ARP36638_T100) antibody is Catalog # AAP36638 (Previous Catalog # AAPP07876) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GJE1 |
| Uniprot ID |
Q8NFK1 |
| Protein Name |
Gap junction gamma-3 protein |
| Protein Accession # |
NP_853516 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_181538 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GJC3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-GJE1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
