GJB4 Antibody - middle region (ARP36633_T100)

• Product Number: ARP36633_T100
• Name: GJB4 Antibody - middle region (ARP36633_T100)
• Protein Size (# AA): 266 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 127534
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Gap junction protein, beta 4, 30.3kDa
• Alias Symbols: EKV, EKVP2, CX30.3
• Peptide Sequence: Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Plantard,L., et al., (2003) Hum. Mol. Genet. 12 (24), 3287-3294
• Description of Target: Connexins are homologous four-transmembrane-domain proteins and major components of gap junctions. The GJB4 gene encodes connexin 30.3 (Cx30.3) A mutation in connexin 30.3 is causally involved in erythrokeratodermia variabilis (EKV), a mostly autosomal dominant disorder of keratinization.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GJB4 (ARP36633_T100) antibody is Catalog # AAP36633 (Previous Catalog # AAPP07871)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GJB4
• Uniprot ID: Q9NTQ9
• Protein Name: Gap junction beta-4 protein
• Protein Accession #: NP_694944
• Purification: Protein A purified
• Nucleotide Accession #: NM_153212
• Tested Species Reactivity: Human
• Gene Symbol: GJB4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-GJB4 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysate