Product Number |
ARP36631_T100 |
Product Page |
www.avivasysbio.com/gjc1-antibody-n-terminal-region-arp36631-t100.html |
Name |
GJC1 Antibody - N-terminal region (ARP36631_T100) |
Protein Size (# AA) |
295 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
125111 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Gap junction protein, delta 3, 31.9kDa |
Alias Symbols |
GJC1, GJA11, CX31.9, Cx30.2 |
Peptide Sequence |
Synthetic peptide located within the following region: IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sohl,G., et al., (2003) Cell Commun. Adhes. 10 (1), 27-36 |
Description of Target |
CX31.9 is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells. |
Protein Interactions |
TJP1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GJD3 (ARP36631_T100) antibody |
Blocking Peptide |
For anti-GJD3 (ARP36631_T100) antibody is Catalog # AAP36631 (Previous Catalog # AAPP07870) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GJC1 |
Uniprot ID |
Q6ZUW6 |
Protein Name |
Gap junction delta-3 protein |
Protein Accession # |
NP_689343 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_152219 |
Tested Species Reactivity |
Human |
Gene Symbol |
GJD3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-GJC1 Antibody Titration: 5.0ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|