GJC1 Antibody - N-terminal region (ARP36631_T100)

Data Sheet
 
Product Number ARP36631_T100
Product Page www.avivasysbio.com/gjc1-antibody-n-terminal-region-arp36631-t100.html
Name GJC1 Antibody - N-terminal region (ARP36631_T100)
Protein Size (# AA) 295 amino acids
Molecular Weight 32kDa
NCBI Gene Id 125111
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Gap junction protein, delta 3, 31.9kDa
Alias Symbols GJC1, GJA11, CX31.9, Cx30.2
Peptide Sequence Synthetic peptide located within the following region: IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sohl,G., et al., (2003) Cell Commun. Adhes. 10 (1), 27-36
Description of Target CX31.9 is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.
Protein Interactions TJP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GJD3 (ARP36631_T100) antibody
Blocking Peptide For anti-GJD3 (ARP36631_T100) antibody is Catalog # AAP36631 (Previous Catalog # AAPP07870)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GJC1
Uniprot ID Q6ZUW6
Protein Name Gap junction delta-3 protein
Protein Accession # NP_689343
Purification Protein A purified
Nucleotide Accession # NM_152219
Tested Species Reactivity Human
Gene Symbol GJD3
Predicted Species Reactivity Human, Mouse, Rat, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-GJC1 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com