| Product Number |
ARP36619_P050 |
| Product Page |
www.avivasysbio.com/ift140-antibody-n-terminal-region-arp36619-p050.html |
| Name |
IFT140 Antibody - N-terminal region (ARP36619_P050) |
| Protein Size (# AA) |
1462 amino acids |
| Molecular Weight |
165kDa |
| NCBI Gene Id |
9742 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Intraflagellar transport 140 homolog (Chlamydomonas) |
| Alias Symbols |
RP80, MZSDS, SRTD9, WDTC2, gs114, c305C8.4, c380F5.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Nakayama,M., (2002) Genome Res. 12 (11), 1773-1784 |
| Description of Target |
IFT140 contains 9 TPR repeats and 5 WD repeats. The function of the IFT140 protein remains unknown. |
| Protein Interactions |
UBC; PFDN1; NEK2; RANBP2; CELSR3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IFT140 (ARP36619_P050) antibody |
| Blocking Peptide |
For anti-IFT140 (ARP36619_P050) antibody is Catalog # AAP36619 (Previous Catalog # AAPP07858) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human IFT140 |
| Uniprot ID |
Q96RY7 |
| Protein Name |
Intraflagellar transport protein 140 homolog |
| Protein Accession # |
NP_055529 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014714 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IFT140 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human brain
 | WB Suggested Anti-IFT140 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain |
|
| Image 2 | human and mouse
 | Sample Type: 1. Human RPE cell line (15ug)
2. Bovine retina lysate cleared at 100,000Xg for 2 hours (15ug)
Primary Dilution: 1:1000
Secondary Anditbody: goat anti-rabbit HRP
Scondary Dilution: 1:10,000
Image Submitted By: Gerald Liew
Stanford University |
|
