GJB2 Antibody - middle region (ARP36608_T100)

Data Sheet
 
Product Number ARP36608_T100
Product Page www.avivasysbio.com/gjb2-antibody-middle-region-arp36608-t100.html
Name GJB2 Antibody - middle region (ARP36608_T100)
Protein Size (# AA) 226 amino acids
Molecular Weight 25kDa
NCBI Gene Id 2706
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Gap junction protein, beta 2, 26kDa
Alias Symbols HID, KID, PPK, BAPS, CX26, DFNA3, DFNB1, NSRD1, DFNA3A, DFNB1A
Peptide Sequence Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hromas,R., et al., (2004) Neurosci. Res. 50 (1), 125-128
Description of Target Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.
Protein Interactions CD14; CNST; FBXO2; SKP1; UBC; GJB6; CAV1; GJB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GJB2 (ARP36608_T100) antibody
Blocking Peptide For anti-GJB2 (ARP36608_T100) antibody is Catalog # AAP36608 (Previous Catalog # AAPP07847)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GJB2
Uniprot ID P29033
Protein Name Gap junction beta-2 protein
Protein Accession # NP_003995
Purification Protein A purified
Nucleotide Accession # NM_004004
Tested Species Reactivity Human
Gene Symbol GJB2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%; Sheep: 86%
Image 1
Human Lung
WB Suggested Anti-GJB2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung
Image 2
Lane 1: 4ug mCx26 elution fraction 6 Lane 2: 4ug mCx26 elution fraction 7 Lane 3: 4ug mCx26 elution fraction 6 + other Cx26 antibody Lane 4: 4ug mCx26 elution fraction 7 + other Cx26 antibody
WB Suggested Anti-GJB2 Antibody
Positive Control: Lane 1: 4ug mCx26 elution fraction 6 Lane 2: 4ug mCx26 elution fraction 7 Lane 3: 4ug mCx26 elution fraction 6 + other Cx26 antibody Lane 4: 4ug mCx26 elution fraction 7 + other Cx26 antibody
Primary Antibody Dilution : 1:3000
Secondary Antibody : Anti-rabbit-HRP
Secondry Antibody Dilution : 1:3000
Submitted by: Juan Zou, Georgia state unviersity
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com