Product Number |
ARP36608_T100 |
Product Page |
www.avivasysbio.com/gjb2-antibody-middle-region-arp36608-t100.html |
Name |
GJB2 Antibody - middle region (ARP36608_T100) |
Protein Size (# AA) |
226 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
2706 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Gap junction protein, beta 2, 26kDa |
Alias Symbols |
HID, KID, PPK, BAPS, CX26, DFNA3, DFNB1, NSRD1, DFNA3A, DFNB1A |
Peptide Sequence |
Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hromas,R., et al., (2004) Neurosci. Res. 50 (1), 125-128 |
Description of Target |
Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43. |
Protein Interactions |
CD14; CNST; FBXO2; SKP1; UBC; GJB6; CAV1; GJB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GJB2 (ARP36608_T100) antibody |
Blocking Peptide |
For anti-GJB2 (ARP36608_T100) antibody is Catalog # AAP36608 (Previous Catalog # AAPP07847) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GJB2 |
Uniprot ID |
P29033 |
Protein Name |
Gap junction beta-2 protein |
Protein Accession # |
NP_003995 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_004004 |
Tested Species Reactivity |
Human |
Gene Symbol |
GJB2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%; Sheep: 86% |
Image 1 | Human Lung
| WB Suggested Anti-GJB2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: Human Lung |
|
Image 2 | Lane 1: 4ug mCx26 elution fraction 6
Lane 2: 4ug mCx26 elution fraction 7
Lane 3: 4ug mCx26 elution fraction 6 + other Cx26 antibody
Lane 4: 4ug mCx26 elution fraction 7 + other Cx26 antibody
| WB Suggested Anti-GJB2 Antibody Positive Control: Lane 1: 4ug mCx26 elution fraction 6
Lane 2: 4ug mCx26 elution fraction 7
Lane 3: 4ug mCx26 elution fraction 6 + other Cx26 antibody
Lane 4: 4ug mCx26 elution fraction 7 + other Cx26 antibody Primary Antibody Dilution : 1:3000 Secondary Antibody : Anti-rabbit-HRP Secondry Antibody Dilution : 1:3000 Submitted by: Juan Zou, Georgia state unviersity |
|