GJB1 Antibody - C-terminal region (ARP36600_T100)

• Product Number: ARP36600_T100
• Name: GJB1 Antibody - C-terminal region (ARP36600_T100)
• Protein Size (# AA): 283 amino acids
• Molecular Weight: 31kDa
• NCBI Gene Id: 2705
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Gap junction protein, beta 1, 32kDa
• Alias Symbols: CMTX, CX32, CMTX1
• Peptide Sequence: Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dagli,M.L., et al., (2004) Carcinogenesis 25 (4), 483-492
• Description of Target: This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.
• Protein Interactions: UBC; VKORC1; APP; CNST; OCLN; PRKACA; SRC; PRKCA; GJB2; CALM1; CAV1; JUP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GJB1 (ARP36600_T100) antibody is Catalog # AAP36600 (Previous Catalog # AAPP07839)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GJB1
• Uniprot ID: P08034
• Protein Name: Gap junction beta-1 protein
• Publications:

  Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

• Protein Accession #: NP_000157
• Purification: Protein A purified
• Nucleotide Accession #: NM_000166
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: GJB1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: HepG2, Human lung
  
  Host: Rabbit
  Target: GJB1
  Positive control (+): HepG2 (HG)
  Negative control (-): Human lung (LU)
  Antibody concentration: 2.5ug/ml
• Image 2: Mouse Spleen
  
  Host: Mouse
  Target Name: GJB1
  Sample Tissue: Mouse Spleen
  Antibody Dilution: 1ug/ml
• Image 3: Human Jurkat
  
  WB Suggested Anti-GJB1 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate
• Image 4: Human Intestine
  
  Human Intestine