| Product Number |
ARP36596_P050 |
| Product Page |
www.avivasysbio.com/chrfam7a-antibody-middle-region-arp36596-p050.html |
| Name |
CHRFAM7A Antibody - middle region (ARP36596_P050) |
| Protein Size (# AA) |
321 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
89832 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion |
| Alias Symbols |
D-10, CHRNA7, NACHRA7, CHRNA7-DR1 |
| Peptide Sequence |
Synthetic peptide located within the following region: DSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Martin,L.F., (2007) Am. J. Med. Genet. B Neuropsychiatr. Genet. 144 (5), 611-614 |
| Description of Target |
The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsych |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHRFAM7A (ARP36596_P050) antibody |
| Blocking Peptide |
For anti-CHRFAM7A (ARP36596_P050) antibody is Catalog # AAPS06305 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CHRFAM7A |
| Uniprot ID |
Q8IUZ4 |
| Protein Name |
Neuronal acetylcholine receptor subunit alpha-7 |
| Protein Accession # |
NP_683709 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_148911 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHRFAM7A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human kidney
 | WB Suggested Anti-CHRFAM7A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human kidney |
|
