Product Number |
ARP36591_T100 |
Product Page |
www.avivasysbio.com/anxa13-antibody-n-terminal-region-arp36591-t100.html |
Name |
ANXA13 Antibody - N-terminal region (ARP36591_T100) |
Protein Size (# AA) |
357 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
312 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Annexin A13 |
Alias Symbols |
ISA, ANX13 |
Peptide Sequence |
Synthetic peptide located within the following region: EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Iglesias,J.M., et al., (2002) Mol. Biol. Evol. 19 (5), 608-618 |
Description of Target |
ANXA13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined; however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. |
Protein Interactions |
NEDD4; UBC; KIFC3; NMT1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ANXA13 (ARP36591_T100) antibody |
Blocking Peptide |
For anti-ANXA13 (ARP36591_T100) antibody is Catalog # AAP36591 (Previous Catalog # AAPP07824) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA13 |
Uniprot ID |
P27216 |
Protein Name |
Annexin A13 |
Protein Accession # |
NP_001003954 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001003954 |
Tested Species Reactivity |
Human |
Gene Symbol |
ANXA13 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 77%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 82%; Pig: 100%; Rabbit: 85%; Rat: 82% |
Image 1 | Human Small Intestine
| WB Suggested Anti-ANXA13 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Human Small Intestine |
|
|