ANXA7 Antibody - N-terminal region (ARP36585_T100)

Data Sheet
 
Product Number ARP36585_T100
Product Page www.avivasysbio.com/anxa7-antibody-n-terminal-region-arp36585-t100.html
Name ANXA7 Antibody - N-terminal region (ARP36585_T100)
Protein Size (# AA) 466 amino acids
Molecular Weight 51kDa
NCBI Gene Id 310
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Annexin A7
Alias Symbols SNX, ANX7, SYNEXIN
Peptide Sequence Synthetic peptide located within the following region: GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Satoh,H., et al., (2002) Biochim. Biophys. Acta 1600 (1-2), 61-67
Description of Target Annexin A7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin A7 gene contains 14 exons and spans approximately 34 kb of DNA. Structural analysis of the protein suggests that Annexin A7 is a membrane binding protein with diverse properties including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion.
Protein Interactions UBC; PAX8; ATP4A; SRC; Prkcb; Prkcg; Prkca; PRKG1; PRKACA; VCP; ANXA4; CUL4B; CUL5; ALG2; ELAVL1; CCDC90B; WDR18; LRIF1; OTUB1; CPSF3L; SEMA5B; INPP5K; ACTL6B; CSAD; SDF4; MED31; TAF5L; TRMT2A; TUBB2B; CPNE2; ZNF431; KLHL23; DOCK7; WDR73; FBN3; RBM48; ADA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ANXA7 (ARP36585_T100) antibody
Blocking Peptide For anti-ANXA7 (ARP36585_T100) antibody is Catalog # AAP36585 (Previous Catalog # AAPP07818)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA7
Uniprot ID Q5T0M6
Protein Name Annexin A7
Protein Accession # NP_001147
Purification Protein A purified
Nucleotide Accession # NM_001156
Tested Species Reactivity Human
Gene Symbol ANXA7
Predicted Species Reactivity Human, Goat
Application WB
Predicted Homology Based on Immunogen Sequence Goat: 83%; Human: 100%
Image 1
Human Liver
WB Suggested Anti-ANXA7 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com