ANXA7 Antibody - N-terminal region (ARP36584_T100)

Data Sheet
 
Product Number ARP36584_T100
Product Page www.avivasysbio.com/anxa7-antibody-n-terminal-region-arp36584-t100.html
Name ANXA7 Antibody - N-terminal region (ARP36584_T100)
Protein Size (# AA) 466 amino acids
Molecular Weight 51kDa
NCBI Gene Id 310
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Annexin A7
Alias Symbols SNX, ANX7, SYNEXIN
Peptide Sequence Synthetic peptide located within the following region: MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Satoh,H., et al., (2002) Biochim. Biophys. Acta 1600 (1-2), 61-67
Description of Target ANXA7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle. The transcripts also differ in their 3'-non coding regions by the use of two alternative poly(A) signals. The selection of poly(A) signals is independent of the mRNA splicing pattern. Annexin VII encodes a protein with a molecular weight of approximately 51 kDa with a unique, highly hydrophobic N-terminal domain of 167 amino acids and a conserved C-terminal region of 299 amino acids. The latter domain is composed of alternating hydrophobic and hydrophilic segments. Structural analysis of the protein suggests that Annexin VII is a membrane binding protein with diverse properties including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion.
Protein Interactions UBC; PAX8; ATP4A; SRC; Prkcb; Prkcg; Prkca; PRKG1; PRKACA; VCP; ANXA4; CUL4B; CUL5; ALG2; ELAVL1; CCDC90B; WDR18; LRIF1; OTUB1; CPSF3L; SEMA5B; INPP5K; ACTL6B; CSAD; SDF4; MED31; TAF5L; TRMT2A; TUBB2B; CPNE2; ZNF431; KLHL23; DOCK7; WDR73; FBN3; RBM48; ADA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ANXA7 (ARP36584_T100) antibody
Blocking Peptide For anti-ANXA7 (ARP36584_T100) antibody is Catalog # AAP36584 (Previous Catalog # AAPP07817)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA7
Uniprot ID Q5T0M6
Protein Name Annexin A7
Protein Accession # NP_001147
Purification Protein A purified
Nucleotide Accession # NM_001156
Tested Species Reactivity Human
Gene Symbol ANXA7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%
Image 1
Human Placenta
WB Suggested Anti-ANXA7 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
Image 2
Human 786-0 Whole Cell
Host: Rabbit
Target Name: ANXA7
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com