Product Number |
ARP36563_P050 |
Product Page |
www.avivasysbio.com/arc-antibody-middle-region-arp36563-p050.html |
Name |
ARC Antibody - middle region (ARP36563_P050) |
Protein Size (# AA) |
396 amino acids |
Molecular Weight |
45 kDa |
NCBI Gene Id |
23237 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Activity-regulated cytoskeleton-associated protein |
Alias Symbols |
hArc, Arg3.1 |
Peptide Sequence |
Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Foo,R.S., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (52), 20826-20831 |
Description of Target |
ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors. |
Protein Interactions |
UBE3A; UBC; KRT15; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-ARC (ARP36563_P050) antibody |
Blocking Peptide |
For anti-ARC (ARP36563_P050) antibody is Catalog # AAP36563 (Previous Catalog # AAPP07714) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ARC |
Uniprot ID |
Q7LC44 |
Protein Name |
Activity-regulated cytoskeleton-associated protein |
Protein Accession # |
NP_056008 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015193 |
Tested Species Reactivity |
Human |
Gene Symbol |
ARC |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Goat, Guinea Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Human Adrenal
| Immunohistochemistry with Adrenal tissue at an antibody concentration of 5ug/ml using anti-ARC antibody (ARP36563_P050) |
|
Image 2 | 293T Cell Lysate, Human Stomach Tumor
| Host: Rabbit Target: ARC Positive control (+): 293T Cell Lysate (2T) Negative control (-): Human Stomach Tumor (T-ST) Antibody concentration: 1ug/ml |
|
Image 3 | Human Fetal Lung
| Host: Rabbit Target Name: ARC Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
Image 4 |
| Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown. |
|