ARC Antibody - middle region (ARP36563_P050)

Data Sheet
 
Product Number ARP36563_P050
Product Page www.avivasysbio.com/arc-antibody-middle-region-arp36563-p050.html
Name ARC Antibody - middle region (ARP36563_P050)
Protein Size (# AA) 396 amino acids
Molecular Weight 45 kDa
NCBI Gene Id 23237
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Activity-regulated cytoskeleton-associated protein
Alias Symbols hArc, Arg3.1
Peptide Sequence Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Foo,R.S., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (52), 20826-20831
Description of Target ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.
Protein Interactions UBE3A; UBC; KRT15;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-ARC (ARP36563_P050) antibody
Blocking Peptide For anti-ARC (ARP36563_P050) antibody is Catalog # AAP36563 (Previous Catalog # AAPP07714)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ARC
Uniprot ID Q7LC44
Protein Name Activity-regulated cytoskeleton-associated protein
Protein Accession # NP_056008
Purification Affinity Purified
Nucleotide Accession # NM_015193
Tested Species Reactivity Human
Gene Symbol ARC
Predicted Species Reactivity Human, Mouse, Rat, Cow, Goat, Guinea Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human Adrenal
Immunohistochemistry with Adrenal tissue at an antibody concentration of 5ug/ml using anti-ARC antibody (ARP36563_P050)
Image 2
293T Cell Lysate, Human Stomach Tumor
Host: Rabbit
Target: ARC
Positive control (+): 293T Cell Lysate (2T)
Negative control (-): Human Stomach Tumor (T-ST)
Antibody concentration: 1ug/ml
Image 3
Human Fetal Lung
Host: Rabbit
Target Name: ARC
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 4

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com