| Product Number |
ARP36534_T100 |
| Product Page |
www.avivasysbio.com/pgbd3-antibody-n-terminal-region-arp36534-t100.html |
| Name |
PGBD3 Antibody - N-terminal region (ARP36534_T100) |
| Protein Size (# AA) |
593 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
267004 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
PiggyBac transposable element derived 3 |
| Peptide Sequence |
Synthetic peptide located within the following region: NLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. Anti-PGBD3 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. Anti-PGBD3 overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12. |
| Protein Interactions |
HOXA11; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PGBD3 (ARP36534_T100) antibody |
| Blocking Peptide |
For anti-PGBD3 (ARP36534_T100) antibody is Catalog # AAP36534 (Previous Catalog # AAPP08589) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PGBD3 |
| Uniprot ID |
Q8N328 |
| Protein Name |
PiggyBac transposable element-derived protein 3 |
| Protein Accession # |
NP_736609 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_170753 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PGBD3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-PGBD3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
