HELB Antibody - N-terminal region (ARP36518_T100)

• Product Number: ARP36518_T100
• Name: HELB Antibody - N-terminal region (ARP36518_T100)
• Protein Size (# AA): 1087 amino acids
• Molecular Weight: 120kDa
• NCBI Gene Id: 92797
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Helicase (DNA) B
• Alias Symbols: DHB, hDHB
• Peptide Sequence: Synthetic peptide located within the following region: FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Taneja,P., et al., (2002) J. Biol. Chem. 277 (43), 40853-40861
• Description of Target: The protein encoded by this gene is a DNA helicase. A dominant-negative mutant of this protein blocks chromosomal DNA replication and suggests that its function is required for S phase entry.
• Protein Interactions: UBC; PMS1; POLA2; POLA1; RPA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HELB (ARP36518_T100) antibody is Catalog # AAP36518 (Previous Catalog # AAPP08573)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HELB
• Uniprot ID: Q8NG08
• Protein Name: DNA helicase B
• Protein Accession #: NP_387467
• Purification: Protein A purified
• Nucleotide Accession #: NM_033647
• Tested Species Reactivity: Human
• Gene Symbol: HELB
• Predicted Species Reactivity: Human, Rat, Cow, Guinea Pig, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Guinea Pig: 79%; Human: 100%; Pig: 86%; Rat: 86%
• Image 1: Human Jurkat
  
  WB Suggested Anti-HELB Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate