TMEM108 Antibody - middle region (ARP36495_T100)

Data Sheet
 
Product Number ARP36495_T100
Product Page www.avivasysbio.com/tmem108-antibody-middle-region-arp36495-t100.html
Name TMEM108 Antibody - middle region (ARP36495_T100)
Protein Size (# AA) 487 amino acids
Molecular Weight 54kDa
NCBI Gene Id 66000
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transmembrane protein 108
Alias Symbols RTLN, CT124
Peptide Sequence Synthetic peptide located within the following region: NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark H.F., et al., (2003) Genome Res. 13:2265-2270
Description of Target TMEM108's function has not been determined yet.
Protein Interactions ARHGEF6; SH3GL2; ANXA7;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMEM108 (ARP36495_T100) antibody
Blocking Peptide For anti-TMEM108 (ARP36495_T100) antibody is Catalog # AAP36495 (Previous Catalog # AAPP08550)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TMEM108
Uniprot ID Q6UXF1-2
Protein Name Transmembrane protein 108
Purification Protein A purified
Tested Species Reactivity Human
Gene Symbol TMEM108
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Brain
WB Suggested Anti-TMEM108 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com