Product Number |
ARP36495_T100 |
Product Page |
www.avivasysbio.com/tmem108-antibody-middle-region-arp36495-t100.html |
Name |
TMEM108 Antibody - middle region (ARP36495_T100) |
Protein Size (# AA) |
487 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
66000 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Transmembrane protein 108 |
Alias Symbols |
RTLN, CT124 |
Peptide Sequence |
Synthetic peptide located within the following region: NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark H.F., et al., (2003) Genome Res. 13:2265-2270 |
Description of Target |
TMEM108's function has not been determined yet. |
Protein Interactions |
ARHGEF6; SH3GL2; ANXA7; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMEM108 (ARP36495_T100) antibody |
Blocking Peptide |
For anti-TMEM108 (ARP36495_T100) antibody is Catalog # AAP36495 (Previous Catalog # AAPP08550) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TMEM108 |
Uniprot ID |
Q6UXF1-2 |
Protein Name |
Transmembrane protein 108 |
Purification |
Protein A purified |
Tested Species Reactivity |
Human |
Gene Symbol |
TMEM108 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Brain
| WB Suggested Anti-TMEM108 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Human brain |
|
|