| Product Number |
ARP36478_P050 |
| Product Page |
www.avivasysbio.com/ddx55-antibody-n-terminal-region-arp36478-p050.html |
| Name |
DDX55 Antibody - N-terminal region (ARP36478_P050) |
| Protein Size (# AA) |
600 amino acids |
| Molecular Weight |
66kDa |
| NCBI Gene Id |
57696 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 |
| Peptide Sequence |
Synthetic peptide located within the following region: RELAIQIDEVLSHFTKHFPEFSQILWIGGRNPGEDVERFKQQGGNIIVAT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Schmid,S.R., et al., (1992) Mol. Microbiol. 6 (3), 283-291 |
| Description of Target |
DDX55 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of only one transcript has been confirmed. |
| Protein Interactions |
KRTAP10-8; AGTRAP; UBC; APP; CAND1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DDX55 (ARP36478_P050) antibody |
| Blocking Peptide |
For anti-DDX55 (ARP36478_P050) antibody is Catalog # AAP36478 (Previous Catalog # AAPP08667) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DDX55 |
| Uniprot ID |
Q8NHQ9 |
| Protein Name |
ATP-dependent RNA helicase DDX55 |
| Protein Accession # |
NP_065987 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020936 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DDX55 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-DDX55 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
