Product Number |
ARP36465_T100 |
Product Page |
www.avivasysbio.com/ddx49-antibody-n-terminal-region-arp36465-t100.html |
Name |
DDX49 Antibody - N-terminal region (ARP36465_T100) |
Protein Size (# AA) |
483 amino acids |
Molecular Weight |
53kDa |
NCBI Gene Id |
54555 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 |
Alias Symbols |
Dbp8, R27090_2 |
Peptide Sequence |
Synthetic peptide located within the following region: ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
The function of Anti-DDX49 has not yet been determined. |
Protein Interactions |
UBC; gag; PSMB2; PNO1; Cebpb; Shcbp1; HAP1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DDX49 (ARP36465_T100) antibody |
Blocking Peptide |
For anti-DDX49 (ARP36465_T100) antibody is Catalog # AAP36465 (Previous Catalog # AAPP08524) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DDX49 |
Uniprot ID |
Q9Y6V7 |
Protein Name |
Probable ATP-dependent RNA helicase DDX49 |
Protein Accession # |
NP_061943 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_019070 |
Tested Species Reactivity |
Human |
Gene Symbol |
DDX49 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 77% |
Image 1 | Human Thymus
| WB Suggested Anti-DDX49 Antibody Titration: 2.5ug/ml ELISA Titer: 1:312500 Positive Control: Human Thymus |
|
|