DDX49 Antibody - N-terminal region (ARP36465_T100)

Data Sheet
 
Product Number ARP36465_T100
Product Page www.avivasysbio.com/ddx49-antibody-n-terminal-region-arp36465-t100.html
Name DDX49 Antibody - N-terminal region (ARP36465_T100)
Protein Size (# AA) 483 amino acids
Molecular Weight 53kDa
NCBI Gene Id 54555
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 49
Alias Symbols Dbp8, R27090_2
Peptide Sequence Synthetic peptide located within the following region: ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target The function of Anti-DDX49 has not yet been determined.
Protein Interactions UBC; gag; PSMB2; PNO1; Cebpb; Shcbp1; HAP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DDX49 (ARP36465_T100) antibody
Blocking Peptide For anti-DDX49 (ARP36465_T100) antibody is Catalog # AAP36465 (Previous Catalog # AAPP08524)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DDX49
Uniprot ID Q9Y6V7
Protein Name Probable ATP-dependent RNA helicase DDX49
Protein Accession # NP_061943
Purification Protein A purified
Nucleotide Accession # NM_019070
Tested Species Reactivity Human
Gene Symbol DDX49
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 77%
Image 1
Human Thymus
WB Suggested Anti-DDX49 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com