| Product Number |
ARP36410_P050 |
| Product Page |
www.avivasysbio.com/ddx25-antibody-c-terminal-region-arp36410-p050.html |
| Name |
DDX25 Antibody - C-terminal region (ARP36410_P050) |
| Protein Size (# AA) |
369 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
29118 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DEAD (Asp-Glu-Ala-Asp) box helicase 25 |
| Alias Symbols |
GRTH |
| Peptide Sequence |
Synthetic peptide located within the following region: TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
A,Z., et al., (2006) Hum. Reprod. 21 (3), 755-759 |
| Description of Target |
DDX25 is a member of DEAD box proteins family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis,spermatogenesis, and cellular growth and division. DDX25 is a gonadotropin-regulated and developmentally expressed testicular RNA helicase. It may serve to maintain testicular functions related to steroidogenesis and spermatogenesis.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The encoded protein is a gonadotropin-regulated and developmentally expressed testicular RNA helicase. It may serve to maintain testicular functions related to steroidogenesis and spermatogenesis. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DDX25 (ARP36410_P050) antibody |
| Blocking Peptide |
For anti-DDX25 (ARP36410_P050) antibody is Catalog # AAP36410 (Previous Catalog # AAPP08466) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DDX25 |
| Uniprot ID |
Q9UHL0-2 |
| Protein Name |
ATP-dependent RNA helicase DDX25 |
| Sample Type Confirmation |
DDX25 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_037396 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_013264 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DDX25 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-DDX25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateDDX25 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
