| Product Number |
ARP36333_P050 |
| Product Page |
www.avivasysbio.com/akap7-antibody-n-terminal-region-arp36333-p050.html |
| Name |
AKAP7 Antibody - N-terminal region (ARP36333_P050) |
| Protein Size (# AA) |
104 amino acids |
| Molecular Weight |
11kDa |
| NCBI Gene Id |
9465 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
A kinase (PRKA) anchor protein 7 |
| Alias Symbols |
AKAP15, AKAP18 |
| Peptide Sequence |
Synthetic peptide located within the following region: MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Brown,R.L., et al., (2003) Biochem. Biophys. Res. Commun. 306 (2), 394-401 |
| Description of Target |
AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined. |
| Protein Interactions |
CEP76; ROPN1; SPA17; PRKAR2B; PRKACB; PRKACA; MEPCE; USP4; PRKAR1A; PRKAR2A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AKAP7 (ARP36333_P050) antibody |
| Blocking Peptide |
For anti-AKAP7 (ARP36333_P050) antibody is Catalog # AAP36333 (Previous Catalog # AAPP07520) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AKAP7 |
| Uniprot ID |
O43687 |
| Protein Name |
A-kinase anchor protein 7 isoforms alpha and beta |
| Protein Accession # |
NP_619539 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_138633 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AKAP7 |
| Predicted Species Reactivity |
Human |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-AKAP7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain |
| | Image 2 | heart
 | Rabbit Anti-AKAP7 Antibody
Catalog Number: ARP36333_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Membrane
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
|
